zGH

Alternative Names: Pituitary growth hormone, Growth hormone 1, Somatotropin, GH1, GH, GHN, GH-N, hGH-N.

GH is a hormone involved in controlling growth, belonging to the somatotropin/prolactin family. Found on chromosome 17 at the growth hormone locus, it is one of five genes arranged in the same orientation due to gene duplications. These genes have a high degree of sequence identity and produce different isoforms through alternative splicing, which contributes to diversity and specialization. This specific gene is expressed in the pituitary but not in placental tissue, unlike the other genes in the locus. Mutations or deletions of this gene cause growth hormone deficiency and short stature.

  •
  • Sku: PSB-cyt-710-10µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Zebrafish Growth Hormone is a synthetic hormone that is derived from the zebrafish species. Belonging to the peptide hormone family, this hormone plays a significant role in regulating growth and development in zebrafish. With a molecular weight of approximately 22 kilodaltons, Recombinant Zebrafish Growth Hormone acts as a crucial factor in controlling various physiological processes, including cell proliferation and differentiation. Its synthetic nature allows for precise manipulation and study of growth-related mechanisms in zebrafish, making it a valuable tool in scientific research.

Current Lead Time

7-14 Days

Product Specifications

Species
 Zebrafish
Expression System E. coli
Purity 99.0% by SDS-PAGE
Activity
 Zebrafish Growth-Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. Zebrafish Growth-Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Monomer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3 pH-8.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL SFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL

Storage Instruction

Lyophilized Zebrafish Growth-Hormone although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized Zebrafish Growth-Hormone in 0.4% NaHCO3 or water adjusted to pH-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

References

Not Available
View full details

zGH
SUBHEADING

Recently viewed products