TARC

Alternative Names: Thymus and activation-regulated chemokine, CC chemokine TARC, C-C motif chemokine 17, Small-inducible cytokine A17, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.

The TARC cDNA encodes a 94 amino acid precursor protein, from which a 23 amino acid signal peptide is cleaved, resulting in a 71 amino acid mature secreted protein. TARC shares amino acid sequence identity with various members of the CC chemokine family. It is primarily expressed in the thymus, with lower levels found in the lung, colon, and small intestine. TARC is also expressed in stimulated peripheral blood mononuclear cells and has been found to be chemotactic for T cell lines but not monocytes or neutrophils. CCL-17, a ligand for the CCR4 receptor expressed on T cells, belongs to the Cys-Cys (CC) cytokine genes clustered on chromosome 16q. CCL17 exhibits chemotactic activity for T lymphocytes and binds to receptors CCR4 and CCR8. It plays important roles in T cell development in the thymus and in the trafficking and activation of mature T cells.

  •
  • Sku: PSB-chm-240-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Thymus and Activation Regulated Chemokine (CCL17) is a chemokine protein belonging to the CC chemokine family. With a molecular weight of approximately 8.6 kDa, CCL17 plays a role in inflammatory responses and immune cell recruitment. This chemokine is involved in the regulation of T cell migration and has been implicated in various inflammatory diseases. Recombinant CCL17 is commonly used in research studies to investigate its biological functions and potential therapeutic applications.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Homodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.

Storage Instruction

Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized CCL17 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

TARC
SUBHEADING

Recently viewed products