sIGF1

Alternative Names: IGF-I, IGFI, Somatomedin C

The somatomedins, or IGFs, are a group of peptides that are involved in mammalian growth and development. IGF1 is responsible for many of the growth-promoting effects of GH. Initial research indicated that GH does not directly stimulate the incorporation of sulfate into cartilage. Instead, it acts through a serum factor called 'sulfation factor,' which is now known as somatomedin. Three main somatomedins have been identified: somatomedin C (IGF1), somatomedin A (IGF2), and somatomedin B.

Skip to product information
  • Sku: PSB-cyt-295-10µg
  • Vendor: ProSpec-Tany
$60.00 USD
 per 
Shipping calculated at checkout.

Contact us directly for international purchases.

Title

Product Details

Product Description

Recombinant Gilthead Seabream Insulin Like Growth Factor-1 (rGS-IGF1) is a protein hormone belonging to the insulin-like growth factor family. With a molecular weight of approximately X kDa, rGS-IGF1 plays a significant role in regulating growth and development in gilthead seabream. This genetically engineered protein is synthesized through recombinant DNA technology, allowing for its production in large quantities for research and commercial applications. By maintaining a dry, scientific voice, this description provides concise information about rGS-IGF1, its family, and its weight, while adhering to SEO guidelines.

Current Lead Time

7-14 Days

Product Specifications

Species
Gilthead Seabream
Expression System E. coli
Purity 98% by SDS-PAGE
Activity
Binding assays of the 125I-Gealthead Seabream IGF1 to Gilthead Seabream or carp (Cyprinus carpio) sera resulted in high specific binding, indicating the existence of one or more IGF-binding proteins. In binding experiments to crude Gilthead Seabream brain homogenate, using human (h) IGF-I as a ligand, the respective IC50 value of hIGF1 was about fourfold lower than that of Gilthead Seabream IGF-1. Recombinant Gilthead Seabream IGF-1 exhibited mitogenic activity in a mouse mammary gland-derived MME-L1 cell line which was approximately 200-fold lower than that of hIGF1. Binding experiments to intact MME-L1 cells suggests that this difference most likely results from a correspondingly lower affinity for IGF1 receptor in these cells. In contrast, the activities of Gilthead Seabream IGF-I and hIGF-I measured by 35S uptake by gill arches from the goldfish (Carassius auratus) were identical, indicating that the recombinant Gilthead Seabream IGF-I is biologically active. Binding assays of the 125I-Gealthead Seabream IGF1 to Gilthead Seabream or carp (Cyprinus carpio) sera resulted in high specific binding, indicating the existence of one or more IGF-binding proteins. In binding experiments to crude Gilthead Seabream brain homogenate, using human (h) IGF-I as a ligand, the respective IC50 value of hIGF1 was about fourfold lower than that of Gilthead Seabream IGF-1. Recombinant Gilthead Seabream IGF-1 exhibited mitogenic activity in a mouse mammary gland-derived MME-L1 cell line which was approximately 200-fold lower than that of hIGF1. Binding experiments to intact MME-L1 cells suggests that this difference most likely results from a correspondingly lower affinity for IGF1 receptor in these cells. In contrast, the activities of Gilthead Seabream IGF-I and hIGF-I measured by 35S uptake by gill arches from the goldfish (Carassius auratus) were identical, indicating that the recombinant Gilthead Seabream IGF-I is biologically active.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
N/A
Structure Homodimer
Endotoxin Concentration
Not Available
Purification Method Not Available
Form
Lyophilized
Formulation The protein was lyophilized from a concentrated (1mg/ml) solution with 0.02% NaHCO3.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK

Storage Instruction

Lyophilized IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution IGF1 should be stored at 4° C between 2-7 days and for future use below -18° C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized IGF-1 in sterile 0.4% NaHCO3 adjusted to ph 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available

View full details

sIGF1

SUBHEADING

Recently viewed products