rTpc1808

Alternative Names: Tpc1808, Tropic 1808.

Tropic 1808 is a chemotropic factor generated by nerve injury that boosts nerve growth through time-dependent stimulation of NF-H expression. Both the Tpc1808 gene and its recombinant protein enhance the expression of NF-H in PC12 cells, similar to NGF.

Skip to product information
  • Sku: PSB-pro-587-10µg
  • Vendor: ProSpec-Tany
$60.00 USD
 per 
Shipping calculated at checkout.

Contact us directly for international purchases.

Title

Product Details

Product Description

Recombinant Rat Tropic 1808 is a genetically engineered protein that specifically targets and binds to rat tropic receptors. Belonging to the family of recombinant proteins, this bioactive molecule exhibits a weight of [weight]. Designed for scientific research purposes, Recombinant Rat Tropic 1808 offers a valuable tool for investigating the role and function of rat tropic receptors in various biological processes. Its precise targeting ability and specific binding characteristics make it an indispensable asset for researchers in the field.

Current Lead Time

7-14 Days

Product Specifications

Species
Rat
Expression System E. coli
Purity 95.0 % by SDS-PAGE
Activity
Not Available
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
N/A
Structure Homodimer
Endotoxin Concentration
Not Available
Purification Method Not Available
Form
Lyophilized
Formulation The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS.

Storage Instruction

Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze-thaw cycles.

References

Not Available

View full details

rTpc1808

SUBHEADING

Recently viewed products