Product Description

Recombinant Human Retinoblastoma Associated Protein, commonly referred to as Rb, is a crucial component of cell cycle regulation. Belonging to the pocket protein family, Rb plays a fundamental role in suppressing tumor formation by inhibiting the progression of cells from the G1 phase to the S phase. With a molecular weight of approximately 110 kDa, this protein acts as a tumor suppressor by binding to transcription factors, thereby preventing their interaction with DNA and impeding cell proliferation. Its significance lies in its ability to maintain genomic stability and control cell division, making it a critical factor in understanding cancer development and potential therapeutic interventions.

Current Lead Time

7-14 Days

Product Specifications

*For Research Use Only

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH.

Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Not Available