Product Description

Recombinant Porcine Trypsin is a genetically engineered form of trypsin, a serine protease enzyme commonly found in the digestive system of pigs. Belonging to the serine protease family, this enzyme plays a vital role in the breakdown of proteins into smaller peptides. With a molecular weight of approximately 24,000 Daltons, Recombinant Porcine Trypsin offers high purity and activity, making it suitable for a wide range of applications in biotechnology, pharmaceutical, and research industries. Its precise and controlled enzymatic activity enables efficient protein digestion, peptide mapping, and protein sequencing, facilitating various downstream processes.

Current Lead Time

7-14 Days

Product Specifications

*For Research Use Only

Notes

Unit Definition: One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0ml at pH7.6 and 25°C, with BAEE as a substrate (1cm light path). Applications: Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w).

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN

Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18° C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Not Available