Product Description

Pramlintide is a synthetic peptide medication primarily used for the treatment of type 1 and type 2 diabetes. Belonging to the amylin analog family, it acts as an adjunct therapy alongside insulin to regulate blood sugar levels. With a molecular weight of approximately 3949.4 Daltons, Pramlintide mimics the effects of amylin, a hormone produced by the pancreas, by slowing down gastric emptying, suppressing glucagon secretion, and promoting satiety. This pharmaceutical compound is prescribed to individuals requiring additional glycemic control and is administered via subcutaneous injection.

Current Lead Time

7-14 Days

Product Specifications

*For Research Use Only

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.

Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.

Not Available