PDI

Alternative Names: Protein Disulfide Isomerase, PDI, PDIA1, EC 5.3.4.1, Prolyl 4-hydroxylase subunit beta, P4HB, P4Hbeta, Cellular thyroid hormone-binding protein, p55, ERBA2L, PO4DB, DSI, GIT, PHDB, PO4HB, PROHB.

Protein disulfide isomerases (PDIs) are enzymes that play a role in catalyzing disulfide bond formation, reduction, and isomerization of proteins within the endoplasmic reticulum. They also act as chaperones to ensure proper folding of proteins in this cellular compartment. Recombinant Human Protein Disulfide Isomerase has shown a 25-fold increase in the rate of oxidative folding of proteins in vitro.

Skip to product information
  • Sku: PSB-enz-262-100µg
  • Vendor: ProSpec-Tany
$175.00 USD
 per 
Shipping calculated at checkout.

Contact us directly for international purchases.

Title

Product Details

Product Description

Recombinant Human Protein Disulfide Isomerase is a member of the protein disulfide isomerase family, responsible for catalyzing the formation and rearrangement of disulfide bonds in proteins. This enzyme plays a crucial role in protein folding and quality control within the endoplasmic reticulum. With a molecular weight of approximately 57 kDa, Recombinant Human Protein Disulfide Isomerase is commonly used in research and biotechnological applications for its ability to assist in the correct folding of recombinant proteins.

Current Lead Time

7-14 Days

Product Specifications

Species
Human
Expression System E. coli
Purity 95% by SDS-PAGE
Activity
Not Available
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
N/A
Structure Dimer
Endotoxin Concentration
Not Available
Purification Method Not Available
Form
Lyophilized
Formulation The PDI protein (1mg/ml)solution was lyophilized from PBS pH-7.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MRGSGSHHHHHHAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKA AGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVN WLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNS DVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIK THILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITL EEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEK KNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFP ASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL

Storage Instruction

Lyophilized Protein Disulfide Isomerase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Human PDI should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized PDI in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available

View full details

PDI

SUBHEADING

Recently viewed products