MIP 5

Alternative Names: Small inducible cytokine A15 precursor, CCL15, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Macrophage inflammatory protein 5, MIP-5, MIP5, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.

A new human CC chemokine, CCL15, was discovered in a human fetal spleen cDNA library. It encodes a 113 amino acid protein, with a signal peptide of 21 amino acids that is cleaved to produce a 92 amino acid mature protein. CCL15 shares varying degrees of amino acid homology with other CC chemokines. It is located on chromosome 17 alongside other human CC chemokine genes. CCL15 is expressed in various immune cells and has been shown to attract T cells and monocytes, as well as induce calcium flux in certain cells.

  •
  • Sku: PSB-chm-230-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Macrophage Inflammatory Protein-5 (CCL15) is a chemokine belonging to the CC subfamily. With a molecular weight of approximately 8.8 kDa, CCL15 plays a role in regulating the migration and activation of various immune cells, particularly macrophages. This protein is involved in inflammatory responses and is known to attract monocytes, T cells, and dendritic cells to sites of infection or tissue damage. Its functions are crucial in the immune system's ability to respond to pathogens and maintain homeostasis.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Homodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.

Storage Instruction

Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

MIP 5
SUBHEADING

Recently viewed products