MCP4

Alternative Names: Small inducible cytokine A13, SCYA13, CCL13, chemokine (C-C motif) ligand 13, NCC-1, NCC1, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, CKb10, SCYL1, MGC17134.

Chemokine CCL13, also known as MCP-4, is a small cytokine that belongs to the CC chemokine family. It is located on human chromosome 17 along with other CC chemokines. MCP-4 induces chemotaxis in various immune cells by binding to specific receptors on the cell surface. Its activity has been linked to allergic reactions like asthma and can be induced by inflammatory cytokines.

  •
  • Sku: PSB-chm-319-2µg
  • Vendor: ProSpec-Tany
$25.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Monocyte Chemotactic Protein-4 (CCL13) is a chemokine belonging to the CC subfamily. With a molecular weight of approximately 8 kDa, CCL13 plays a role in the recruitment and activation of monocytes, eosinophils, and T lymphocytes. This chemokine is involved in the regulation of inflammatory responses and immune cell migration. Recombinant CCL13 is commonly used in research settings to study chemotaxis and immune cell function.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 96.0% by SDS-PAGE
Activity
 The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100ng/ml, corresponding to a Specific Activity of 10,000-100,000 units/mg. The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100ng/ml, corresponding to a Specific Activity of 10,000-100,000 units/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Homodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.

Storage Instruction

Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

MCP4
SUBHEADING

Recently viewed products