Product Description

Recombinant Human LR3 Insulin Like Growth Factor-1 (IGF-1) is a synthetic form of a naturally occurring protein hormone. Belonging to the insulin-like growth factor family, it plays a significant role in cellular growth, proliferation, and differentiation. With a molecular weight of approximately 9,119 Daltons, this recombinant variant is produced through genetic engineering techniques. Its precise structure and sequence closely resemble the endogenous IGF-1, enabling it to bind to the IGF-1 receptor and activate downstream signaling pathways. This bioengineered product is commonly used in research and therapeutic applications due to its ability to regulate various physiological processes.

Current Lead Time

7-14 Days

Product Specifications

*For Research Use Only

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.

Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H₂O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions.

Not Available