IP10

Alternative Names: Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.

CXCL10 is a small cytokine in the CXC chemokine family, secreted by various cell types in response to IFN. It plays roles in attracting monocytes and T cells, aiding T cell adhesion to endothelial cells, exerting antitumor effects, and hindering bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 among other CXC chemokines. This chemokine binds to the cell surface chemokine receptor CXCR3. Its three-dimensional crystal structure has been determined under 3 different conditions with a resolution up to 1.92A.

  •
  • Sku: PSB-chm-330-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human IP-10 (CXCL10) is a chemokine belonging to the CXC subfamily. It plays a significant role in the immune response by attracting and activating T cells, monocytes, and natural killer cells. With a molecular weight of approximately 8.7 kDa, Recombinant Human IP-10 is commonly used in research and therapeutic applications to study inflammation, autoimmune diseases, and cancer.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 95.0 % by SDS-PAGE
Activity
 Not Available
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP.

Storage Instruction

Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

IP10
SUBHEADING

Recently viewed products