I TAC

Alternative Names: Small inducible cytokine B11, SCYB11, CXCL11, I-TAC, IP-9, IP9, H174, Beta-R1, b-R1, chemokine (C-X-C motif) ligand 11, SCYB9B, MGC102770.

Chemokine CXCL11, also known as I-TAC and IP-9, is a small cytokine in the CXC chemokine family. It is highly expressed in peripheral blood leukocytes, pancreas, and liver, with moderate levels in thymus, spleen, and lung, and low levels in small intestine, placenta, and prostate. Gene expression of CXCL11 is induced by IFN-g and IFN-b, and weakly by IFN-a. CXCL11 interacts with CXCR3 receptor on target cells with higher affinity than other ligands, such as CXCL9 and CXCL10. I-TAC is chemotactic for activated T cells and is located on human chromosome 4 with other CXC chemokine family members.

  •
  • Sku: PSB-chm-334-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human I-TAC (CXCL11) is a chemokine protein belonging to the CXC chemokine family. It plays a role in immune response by attracting and activating immune cells to sites of inflammation. With a molecular weight of approximately 9.8 kDa, Recombinant Human I-TAC (CXCL11) is commonly used in research and clinical applications to study the chemotactic properties of immune cells. Its ability to regulate immune cell migration makes it a valuable tool in understanding the mechanisms of inflammation and immune system function.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml. Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF.

Storage Instruction

Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution I-TAC should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized I-TAC in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

I TAC
SUBHEADING

Recently viewed products