HCC 1

Alternative Names: Small inducible cytokine A14, SCYA14, CCL14, chemokine CC-1/CC-3, CC-1, CC-3, HCC-1, HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CKb1, MCIF, SY14, SCYL2.

Chemokine CCL14, also known as HCC-1, is a small cytokine in the CC chemokine family. It shares similarities with CCL3 and CCL4, containing 74 amino acids. CCL14 is expressed in tissues like spleen, bone marrow, liver, muscle, and gut. It activates monocytes but does not induce their chemotaxis. It is located on chromosome 17 with other CC chemokines.

  •
  • Sku: PSB-chm-311-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human HCC-1 (CCL14) is a chemokine protein belonging to the CC chemokine family. It plays a role in immune response and inflammation by attracting immune cells to sites of infection or injury. With a molecular weight of approximately 8.5 kDa, Recombinant Human HCC-1 (CCL14) is commonly used in research settings to study chemotaxis and leukocyte recruitment.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg. The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Monomer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN.

Storage Instruction

Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

HCC 1
SUBHEADING

Recently viewed products