GUCA2B

Alternative Names: Guanylate cyclase activator 2B, GCAP-II, GUCA2B, UGN

Prouroguanylin is a prohormone precursor of uroguanylin, a 16-amino-acid peptide that activates receptor-guanylate cyclases and increases intracellular cGMP levels. This leads to the activation of CFTCR, resulting in fluid and electrolyte secretion into the lumen. Knock-out mice lacking prouroguanylin showed impaired renal excretion of NaCl, leading to elevated blood pressure regardless of dietary salt intake. Prouroguanylin is the main form found in circulation and biological fluids.

Skip to product information
  • Sku: PSB-hor-245-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
 per 
Shipping calculated at checkout.

Contact us directly for international purchases.

Title

Product Details

Product Description

Recombinant Human Prouroguanylin is a synthetic form of the prohormone proguanylin, which belongs to the guanylin family of peptides. With a molecular weight of approximately 6.2 kDa, this protein plays a role in regulating electrolyte and fluid balance in the gastrointestinal tract. Recombinant Human Prouroguanylin is commonly used in research settings to study its effects on intestinal function and its potential therapeutic applications in gastrointestinal disorders.

Current Lead Time

7-14 Days

Product Specifications

Species
Human
Expression System E. coli
Purity 95.0% by SDS-PAGE
Activity
Not Available
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
N/A
Structure Dimer
Endotoxin Concentration
Not Available
Purification Method Not Available
Form
Frozen
Formulation 20mM TRIS, 50mM NaCl and 20% (v/v) glycerol, pH 7.5.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MKHHHHHHASVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLP AVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL.

Storage Instruction

Reconstituted store at -20°C or -80°C.We recommend that single use aliquots are prepared to avoid freeze-thaw cycles.

Sample Prep Instruction

1. Thaw the vial on ice, spin briefly
2. Prepare single-use or stock aliquots. This stage will depend on your final application so please adapt as appropriate. All our proteins are supplied carrier protein-free. If compatible with your work and you are storing at lower concentrations (<50 ug/ml) adding carrier protein is highly advised (usually 1% w/v high purity BSA or equivalent – ensure all buffers are sterile-filtered).
3. Prepare single-use aliquots whenever possible to avoid freeze-thaw cycles which can damage the proteins and reduce bioactivity. Store aliquots at -70 °C (or -20 °C)
4. We recommend sterile filtering after dilution in media or the final working solution

References

Not Available

View full details

GUCA2B

SUBHEADING

Recently viewed products