FSH

Alternative Names: Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, FSH, Follitropin subunit beta, Follitropin beta chain

FSH is a hormone produced by the anterior pituitary gland that works in conjunction with LH to support reproduction. In women, FSH promotes the growth of immature Graafian follicles in the ovaries until they mature, at which point inhibin is released to halt FSH production. In men, FSH aids in the production of androgen-binding protein by testicular Sertoli cells and is essential for spermatogenesis. FSH also plays a role in stimulating germ cell maturation in both sexes. For females, FSH kick-starts follicular growth by targeting granulosa cells, with inhibin B levels subsequently decreasing FSH levels during the late follicular phase to select the most advanced follicle for ovulation. A slight increase in FSH at the end of the luteal phase is believed to be crucial for initiating the next ovulatory cycle. FSH release in the pituitary gland is regulated by pulses of GnRH, which are influenced by estrogen feedback from the gonads, similar to LH.

  •
  • Sku: PSB-hor-253-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Follicle Stimulating Hormone (r-hFSH) is a synthetic hormone used in fertility treatments to stimulate the development of ovarian follicles. Belonging to the glycoprotein hormone family, r-hFSH has a molecular weight of approximately 30 kDa. This hormone plays a key role in the regulation of reproductive processes and is commonly used in assisted reproductive technologies to induce ovulation in women undergoing infertility treatment.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System HEK 293
Purity 95% by SDS-PAGE
Activity
 The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Activity Assay
Animal Component Free (ACF) No
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The recombinant FSH was lyophilized from 0.2µm filtered solution containing PBS, pH 7.4.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLR SKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.

Storage Instruction

Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ-cm H₂O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

FSH
SUBHEADING

Recently viewed products