Fractalkine

Alternative Names: Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine.

Fractalkine, in both soluble and membrane-bound forms, plays a role in regulating leukocyte adhesion and migration processes at the endothelium. The soluble form attracts t-cells and monocytes, while the membrane-bound form promotes adhesion of these leukocytes to endothelial cells. Fractalkine binds to CX3CR1 and is produced as a large protein with a mucin-like stalk that allows it to bind to the cell surface. The Fractalkine gene is located on human chromosome 16 near other CC chemokines such as CCL17 and CCL22.

  •
  • Sku: PSB-chm-235-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Fractalkine (CX3CL1) is a chemokine protein that belongs to the CX3C chemokine family. With a molecular weight of approximately 95 kDa, CX3CL1 plays a role in mediating adhesion and migration of leukocytes. Its unique structure, consisting of both a chemokine domain and a mucin-like stalk, allows for interactions with its receptor, CX3CR1, which is expressed on various immune cells. Recombinant Human Fractalkine is commonly used in research studies to investigate its role in inflammation and immune responses.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg. The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Homodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The CX3CL1 was lyophilized from a 0.2μm filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.

Storage Instruction

Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

Fractalkine
SUBHEADING

Recently viewed products