FKBP1A

Alternative Names: FKBP12, FKBP-12, FKBP12C, 12 kDa FKBP, FKBP1, FKBP1A, FKBP-1A, FKBP1A, PPIase FKBP1A, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FK506-binding protein 1A, PKC12, PKCI2

FKBP1A is a 12kDa protein that was first identified in immune cells due to its binding ability with the immunosuppressant FK506. It is also involved in the action of the immunosuppressive agent Rapamycin. As a member of the immunophilin family, FKBP1A has high affinity for immunosuppressant drugs and possesses a peptidyl-prolyl cis-trans isomerase (PPIase) activity, which aids in the folding of proline-containing proteins. When not bound to immunosuppressive ligands, FKBP1A is involved in regulating intracellular calcium levels by interacting with calcium release channel complexes. Additionally, it interacts with the TGF-b type I receptor to inhibit the TGF-b signaling pathway. FKBP1A also plays a role in modulating ryanodine receptor isoform-1 (ryr-1), a component of the calcium release channel in skeletal muscle sarcoplasmic reticulum. Overall, FKBP1A enhances protein folding and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

  •
  • Sku: PSB-enz-374-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human FK506 Binding Protein 1A, also known as FKBP1A, is a member of the immunophilin protein family. This protein plays a role in protein folding and is involved in the regulation of the immune response. FKBP1A has a molecular weight of approximately 12 kDa and is commonly used in research and therapeutic applications due to its ability to bind to the immunosuppressive drug FK506. This recombinant protein is often utilized in studies related to protein-protein interactions and drug development.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 99.0% by SDS-PAGE
Activity
 Not Available
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Homodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Frozen
Formulation The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

The amino acid sequence of recombinant His-tagged FKBP12 is reported as following:MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE.

Storage Instruction

Reconstituted store at -20°C or -80°C.We recommend that single use aliquots are prepared to avoid freeze-thaw cycles.

Sample Prep Instruction

1. Thaw the vial on ice, spin briefly
2. Prepare single-use or stock aliquots. This stage will depend on your final application so please adapt as appropriate. All our proteins are supplied carrier protein-free. If compatible with your work and you are storing at lower concentrations (<50 ug/ml) adding carrier protein is highly advised (usually 1% w/v high purity BSA or equivalent – ensure all buffers are sterile-filtered).
3. Prepare single-use aliquots whenever possible to avoid freeze-thaw cycles which can damage the proteins and reduce bioactivity. Store aliquots at -70 °C (or -20 °C)
4. We recommend sterile filtering after dilution in media or the final working solution
​

References

Not Available
View full details

FKBP1A
SUBHEADING

Recently viewed products