FGFR1

Alternative Names: basic fibroblast growth factor receptor 1, bFGF-R, BFGFR, BFGFR, C-FGR, CD331, CEK, FGFBR, FGFR-1, FGFR1/FGFR1OP2 FUSION GENE, FGFR1/ZNF198 FUSION GENE, FLG, FLG FGFR1/BCR FUSION GENE, FLG protein, FLT2, fms-related tyrosine kinase 2, FMS-LIKE GENE, HBGFR, KAL2, N-sam tyrosine kinase, Pfeiffer syndrome.

Fibroblast Growth Factors (FGFs) are a family of proteins involved in various cellular processes such as cell growth, differentiation, angiogenesis, wound healing, and tumorgenesis. Their activities are mediated by a family of transmembrane tyrosine kinases, specifically four genes encoding FGF receptors (FGFR-1 to -4). Alternative splicing of mRNA leads to the generation of multiple forms of FGFR-1 to -3, including alpha and beta isoforms. Mutations in FGFR-1 to -3 have been linked to birth defects related to craniosynostosis.

Skip to product information
  • Sku: PSB-pka-230-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
 per 
Shipping calculated at checkout.

Contact us directly for international purchases.

Title

Product Details

Product Description

Recombinant Human Fibroblast Growth Factor Receptor-1 (FGFR-1) is a protein belonging to the fibroblast growth factor receptor family. It plays a key role in cell growth, differentiation, and survival. With a molecular weight of approximately 120 kDa, FGFR-1 is involved in various cellular processes, including embryonic development and tissue repair. This receptor is essential for mediating the effects of fibroblast growth factors on cell proliferation and migration.

Current Lead Time

7-14 Days

Product Specifications

Species
Human
Expression System Insect Cell
Purity 90% by SDS-PAGE
Activity
Determined by its ability to inhibit human FGF acidic-dependent proliferation on R1 cells. The ED50 for this effect is typically at 15.0-30.0 ng/ml. Determined by its ability to inhibit human FGF acidic-dependent proliferation on R1 cells. The ED50 for this effect is typically at 15.0-30.0 ng/ml.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
N/A
Structure Homodimer
Endotoxin Concentration
Not Available
Purification Method Not Available
Form
Lyophilized
Formulation CD331 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQL AESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSS EDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFK CPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYT CIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYS DPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSF EDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEDPRRASIEG RGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK

Storage Instruction

Lyophilized FGFR1A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGFR1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized bFGF-R in sterile PBS not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available

View full details

FGFR1

SUBHEADING

Recently viewed products