Eotaxin 2

Alternative Names: C-C motif chemokine 24, CCL24, Eotaxin-2, Eotaxin2, CCL-24, Small-inducible cytokine A24, SCYA24, Myeloid progenitor inhibitory factor 2, MPIF2, MPIF-2, CK-beta-6, Ckb-6, Eosinophil chemotactic protein 2.

Eotaxin-2 is a CC chemokine that is produced by activated monocytes and T lymphocytes. It attracts cells expressing CCR3, such as eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Eotaxin-2 also inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein is 78 amino acids long (92 amino acids for the mouse homolog, without C-terminal truncation). CCL24 acts as a chemotactic chemokine for resting T lymphocytes and eosinophils, with lower activity for neutrophils. It does not attract monocytes or activated lymphocytes. CCL24 suppresses colony formation by multipotential hematopoietic progenitor cells and binds to CCR3.

  •
  • Sku: PSB-chm-238-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Eotaxin-2 (CCL24) is a chemokine protein that belongs to the CC chemokine family. It plays a role in the regulation of immune responses and inflammation by attracting eosinophils to sites of infection or injury. With a molecular weight of approximately 8.8 kDa, Recombinant Human Eotaxin-2 is commonly used in research studies to investigate its function and potential therapeutic applications in various inflammatory diseases.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg. The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.

Storage Instruction

Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

Eotaxin 2
SUBHEADING

Recently viewed products