Endoglin, Sf9

Alternative Names: CD105, ENG, END, Endoglin, ORW, HHT1, ORW1, FLJ41744

Endoglin is a membrane glycoprotein involved in the TGF beta receptor complex found on the surfaces of various cell types. It forms a homodimer structure with disulfide links and has been observed in endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Endoglin is believed to play a role in binding TGF-beta1, TGF-beta3, activin-A, BMP-2, and BMP-7. In addition to its involvement in TGF-beta signaling, endoglin may impact cytoskeletal organization, affecting cell morphology and migration. It is crucial for cardiovascular system development and vascular remodeling, with its expression regulated during heart development. Mice lacking the endoglin gene have been shown to exhibit cardiovascular abnormalities.

  •
  • Sku: PSB-cyt-389-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Endoglin, Sf9 is a protein belonging to the TGF-beta receptor family. With a molecular weight of approximately 65 kDa, this protein plays a role in regulating cell growth and differentiation. Produced in Sf9 insect cells using recombinant DNA technology, Recombinant Human Endoglin is commonly used in research studies to investigate its involvement in various cellular processes.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System Sf9 - Insect cells
Purity 95% by SDS-PAGE
Activity
 Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application. Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation Endoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTY TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLID ANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPL ASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNI LSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSE FLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPI PKTGTLSCTVALRPKTGS.

Storage Instruction

Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD105 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized CD-105 in sterile PBS not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

Endoglin, Sf9
SUBHEADING

Recently viewed products