EBI3

Alternative Names: Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.

Upon Epstein-Barr virus infection, B lymphocytes exhibit induced expression of EBI3, a secreted glycoprotein that belongs to the hematopoietin receptor family. EBI3 forms a heterodimer with a 28 kDa protein to create iIL-27, which drives quick clonal expansion of naive cd4(+) t-cells. It synergizes with IL-12 to activate IFN-gamma production in naive cd4(+) t-cells and mediates its effects through the cytokine receptor wsx-1/tccr.

  •
  • Sku: PSB-cyt-367-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Epstein Barr Virus Induced 3 is a protein that belongs to the Epstein-Barr virus family. With a molecular weight of approximately 150 kDa, this protein plays a role in the viral life cycle and pathogenesis. It is commonly used in research studies to investigate the mechanisms of Epstein-Barr virus infection and replication. Its recombinant form allows for controlled experimentation and analysis of its functions in various cellular processes.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 90% by SDS-PAGE
Activity
 Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody. Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 23.3 kDa
Structure Heterodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.

Storage Instruction

Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

EBI3
SUBHEADING

Recently viewed products