BCA1

Alternative Names: C-X-C motif chemokine 13, Small-inducible cytokine B13, B lymphocyte chemoattractant, CXC chemokine BLC, CXCL13, BCA1, BCA-1, CXCL-13, B cell Attracting Chemokine-1, BLC, ANGIE, BLR1L, SCYB13, ANGIE2.

BCA-1 is a CXC chemokine expressed primarily in secondary lymphoid organs, including the spleen, lymph nodes, and Peyer's patches. It promotes the migration of B lymphocytes by stimulating calcium influx and chemotaxis in cells expressing BLR1. BCA-1 plays a key role in homing B lymphocytes to follicles. Human BCA-1 has a 64% amino acid sequence similarity with the mouse protein and 23-34% similarity with other CXC chemokines. Recombinant or chemically synthesized BCA1 selectively attracts B lymphocytes, not T lymphocytes, monocytes, or neutrophils. BLR1, originally identified in Burkitt’s lymphoma cells, is the specific receptor for BCA1. CXCR-5 is now the designated name for BLR1 and is expressed only in B lymphocytes and a subset of T helper memory cells in the hematopoietic lineages.

  •
  • Sku: PSB-chm-348-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human BCA-1/BLC (CXCL13) is a chemokine protein belonging to the CXC subfamily. This protein plays a role in the recruitment of B cells to lymphoid follicles and is involved in the regulation of immune responses. With a molecular weight of approximately 10 kDa, Recombinant Human BCA-1/BLC (CXCL13) is commonly used in research settings to study the chemotactic properties of B cells in various biological processes.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 97.0% by SDS-PAGE
Activity
 Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation The BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP.

Storage Instruction

Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BCA1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized CXCL13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

BCA1
SUBHEADING

Recently viewed products