BAFFR

Alternative Names: B cell-activating factor receptor, TNFRSF13C, CD268, BAFF-R, MGC138235

BAFF, a protein that promotes B-cell survival, is a key regulator of the peripheral B-cell population. Studies have shown that overexpression of BAFF in mice leads to an increase in mature B cells and symptoms similar to systemic lupus erythematosus (SLE). Additionally, some SLE patients exhibit elevated levels of BAFF in their blood. This has led to the hypothesis that abnormally high BAFF levels may contribute to the development of autoimmune diseases by promoting the survival of autoreactive B cells. The protein encoded by a specific gene acts as a receptor for BAFF and is believed to be essential for BAFF-mediated mature B-cell survival.

  •
  • Sku: PSB-cyt-429-10µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human BAFF (BLyS) Receptor is a protein belonging to the tumor necrosis factor receptor superfamily. It plays a key role in regulating B cell survival and maturation. With a molecular weight of approximately 20-30 kDa, this receptor is involved in the activation of the NF-kappaB and JNK signaling pathways. Its recombinant form is commonly used in research studies to investigate the mechanisms underlying B cell development and function.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 95% by SDS-PAGE
Activity
 Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Homodimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.

Storage Instruction

Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

BAFFR
SUBHEADING

Recently viewed products