AHSG HEK

Alternative Names: Alpha-2-HS-glycoprotein, Fetuin-A, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, AHSG, FETUA, AHS, A2HS, HSGA, PRO2743.

Fetuin is a liver-produced protein made up of two subunits: A and B chains. Homologs of fetuin have been discovered in various species. These homologs have been found to play multiple roles, such as binding to hydroxyapatite crystals and inhibiting the activity of a receptor called tyrosine kinase (TK). One type of fetuin, called fetuin-A or AHSG, is an important inhibitor of calcification in the body. During times of acute inflammation, the levels of AHSG decrease. Patients on long-term dialysis with low AHSG levels have shown reduced ability to prevent calcium phosphate precipitation. Additionally, fetuin may play a role in resolving inflammation by influencing the uptake of dying cells by immune cells called macrophages. In osteoblastic cells, AHSG can block a signaling pathway called TGF-beta-dependent signaling. Mice lacking AHSG display defects in their growth plates, increased bone formation as they age, and enhanced cytokine-driven bone tissue formation.

  •
  • Sku: PSB-pro-1644-2µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Alpha-2-HS-Glycoprotein HEK is a protein that belongs to the alpha-2-HS-glycoprotein family. With a molecular weight of approximately [insert weight], this protein plays a significant role in various biological processes. It is involved in regulating calcium metabolism, inhibiting the formation of calcium phosphate crystals, and modulating immune responses. Recombinant Human Alpha-2-HS-Glycoprotein HEK is widely used in scientific research and pharmaceutical development due to its potential therapeutic applications.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System HEK 293
Purity 95% by SDS-PAGE
Activity
 Not Available
Activity Assay
Animal Component Free (ACF) No
Molecular Weight
 N/A
Structure Monomer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Lyophilized
Formulation AHSG was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, pH 7.5.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH.

Storage Instruction

Lyophilized AHSG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution AHSG should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Sample Prep Instruction

It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

References

Not Available
View full details

AHSG HEK
SUBHEADING

Recently viewed products