Acrp30

Alternative Names: AdipoQ, APM-1, Acrp30, GBP-28, ACDC.

Adiponectin, exclusively produced and released by adipose tissue, plays a significant role in energy balance, insulin sensitivity, hormonal regulation, and fat metabolism. Lower levels of Adiponectin are associated with insulin resistance and high insulin levels, commonly observed in individuals with obesity, insulin resistance, and type 2 diabetes. The structure of Adiponectin consists of a collagenous domain at the N-terminus and a globular domain at the C-terminus. Beyond its metabolic functions, Adiponectin also functions as a negative regulator in hematopoiesis and the immune system, potentially modulating inflammatory responses. Adiponectin inhibits NF-kappa-b signaling in endothelial cells through a cAMP-dependent mechanism and suppresses the expression of endothelial adhesion molecules induced by TNF-alpha.

  •
  • Sku: PSB-cyt-280-5µg
  • Vendor: ProSpec-Tany
$60.00 USD
Shipping calculated at checkout.

Contact us directly for international purchases.

Title
Report Product Listing Issue (e.g. Missing Data, or Questions)
Safety Data Sheet
UniProt Listing
NCBI Link

Product Details

Product Description

Recombinant Human Adiponectin is a protein belonging to the adipokine family, known for its role in regulating glucose levels and fatty acid breakdown in the body. With a molecular weight of approximately 30 kDa, this protein plays a significant role in metabolic processes and has been studied for its potential therapeutic applications in various metabolic disorders. Recombinant Human Adiponectin is produced through genetic engineering techniques, making it a valuable tool for research and drug development in the field of metabolic diseases.

Current Lead Time

7-14 Days

Product Specifications

Species
 Human
Expression System E. coli
Purity 90% by SDS-PAGE
Activity
 Not Available
Activity Assay
Animal Component Free (ACF) Yes
Molecular Weight
 N/A
Structure Dimer
Endotoxin Concentration
 Not Available
Purification Method Not Available
Form
 Frozen
Formulation Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.

*For Research Use Only

Product Guarantee

If your product is within its expiration period, and has not performed according to expectations, fill out the sample return form. Return the unused sample frozen, with the auto generated packing slip to the address on the instructions. You will receive a full refund along with a replacement of the unused portion (inclusive of the failed test). Damages do not cover any additional costs incurred for failed experimentation. 

Amino Acid Sequence

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.

Storage Instruction

Reconstituted store at -20°C or -80°C.We recommend that single use aliquots are prepared to avoid freeze-thaw cycles.

Sample Prep Instruction

1. Thaw the vial on ice, spin briefly
2. Prepare single-use or stock aliquots. This stage will depend on your final application so please adapt as appropriate. All our proteins are supplied carrier protein-free. If compatible with your work and you are storing at lower concentrations (<50 ug/ml) adding carrier protein is highly advised (usually 1% w/v high purity BSA or equivalent – ensure all buffers are sterile-filtered).
3. Prepare single-use aliquots whenever possible to avoid freeze-thaw cycles which can damage the proteins and reduce bioactivity. Store aliquots at -70 °C (or -20 °C)
4. We recommend sterile filtering after dilution in media or the final working solution
​

References

Not Available
View full details

Acrp30
SUBHEADING

Recently viewed products